PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010910754.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 290aa    MW: 32401 Da    PI: 8.005
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010910754.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.15e-5181321128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL++k+++ +l +  +i+e+d+yk++Pw+Lp ++ ++ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk++ + 
  XP_010910754.1   8 LPPGFRFHPTDEELMMHYLCRKCAALPLAV-PIIAEIDLYKFDPWQLPGMALHGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPIGT- 100
                     79*************************999.88***************76677899************************************99. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + vg+kk Lvfy+g+ap+g kt+W+mheyrl
  XP_010910754.1 101 -PKPVGIKKALVFYSGKAPRGLKTNWIMHEYRL 132
                     .789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-625158IPR003441NAC domain
PROSITE profilePS5100560.2878158IPR003441NAC domain
PfamPF023651.8E-269132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MSGGDLHLPP GFRFHPTDEE LMMHYLCRKC AALPLAVPII AEIDLYKFDP WQLPGMALHG  60
EKEWYFFSPR DRKYPNGSRP NRAAGSGYWK ATGADKPIGT PKPVGIKKAL VFYSGKAPRG  120
LKTNWIMHEY RLADVDRSAR KKNSLRLDDW VLCRIYNKKG GAEKAAGSDR KAAGSRTVVL  180
PEPERKPVFV PHVPDLVHFD PADSMPRLHA DSSCSEQVLS PEVTWEREVQ SQPQAAWSHW  240
EKALNVPLNN DGAAAAAGGV EFFPQLEPGS LEPEFSDPLQ DILMYLGKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-79616418174NAC domain-containing protein 19
3swm_B2e-79616418174NAC domain-containing protein 19
3swm_C2e-79616418174NAC domain-containing protein 19
3swm_D2e-79616418174NAC domain-containing protein 19
3swp_A2e-79616418174NAC domain-containing protein 19
3swp_B2e-79616418174NAC domain-containing protein 19
3swp_C2e-79616418174NAC domain-containing protein 19
3swp_D2e-79616418174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010910754.10.0PREDICTED: NAC domain-containing protein 48-like
SwissprotQ7F2L31e-134NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLA0A059ZXH81e-137A0A059ZXH8_BOENI; NAC domain-containing protein
STRINGSb03g041920.11e-134(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-121NAC family protein